Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.005G087800.1
Common NamePHAVU_005G087800g
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family NZZ/SPL
Protein Properties Length: 303aa    MW: 33168.7 Da    PI: 7.1019
Description NZZ/SPL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.005G087800.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
              NOZZLE  42 srgrkpgsktaqqkqkkptlrgmgvaklerfiieeekkklvvatvgdtssvaaisnta....trlpvpvdrgvvlqgfps......slgss 122
                          r r    +t  +  kkp  rg+gva+ler +i+e  kk+   + g     a           r p p + g  +q           +g++
                         345555678899999*************************9999988774444433331111456633.4566555433355566666765 PP

              NOZZLE 123 rilcg.gvgsgqvmidpvispwgfvetsatthelssisnpqmynassnnrcdtcfkkkrldgdqnnvvrsngggfskytmipppmngyde. 211
                          i+    vg g     p +     +ets    elssi+n      s  +  d c+kk r++ d++    sn         +    ng+d  
                         55443135666666666555555677776...*****9964....5556569*********9983..3444443...33333333666651 PP

              NOZZLE 212 .yllqsdhhq..rsqgflydqriaraasvsa.asasinpyfne..atnltgsreefgsvl..egnprngsrgv..keyeffp.gkydervs 291
                          ++ qs   +       +yd ++ar  s sa a a+ n    e  a    g+      ++  e  p +  rg   ke ef   g      +
                         14444443221123445777.5788776555244555655555222333343322222331133454444443125666532133322222 PP

              NOZZLE 292 .kvakvaslvgdcspntidlslkl 314
                           +  +a++ gd + n idlslkl
  Phvul.005G087800.1 277 eASSITAAAYGDSASNYIDLSLKL 300
                         134556778899999999999997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF087442.0E-1118280IPR014855Plant transcription factor NOZZLE
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150400.0AP015040.1 Vigna angularis var. angularis DNA, chromosome 7, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007149653.10.0hypothetical protein PHAVU_005G087800g
TrEMBLV7BUH90.0V7BUH9_PHAVU; Uncharacterized protein
STRINGGLYMA13G35881.11e-140(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G27330.17e-07sporocyteless (SPL)